Lineage for d1tj1a2 (1tj1 A:262-610)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2102263Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2102316Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 proteins)
    automatically mapped to Pfam PF01619
  6. 2102317Protein Proline dehydrohenase domain of bifunctional PutA protein [82280] (2 species)
  7. 2102323Species Escherichia coli [TaxId:562] [82281] (7 PDB entries)
    Uniprot P09546 87-610
  8. 2102329Domain d1tj1a2: 1tj1 A:262-610 [112435]
    Other proteins in same PDB: d1tj1a1
    complexed with 2op, fad

Details for d1tj1a2

PDB Entry: 1tj1 (more details), 2 Å

PDB Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with L-lactate
PDB Compounds: (A:) Bifunctional putA protein

SCOPe Domain Sequences for d1tj1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tj1a2 c.1.23.2 (A:262-610) Proline dehydrohenase domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrlleng
antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprd

SCOPe Domain Coordinates for d1tj1a2:

Click to download the PDB-style file with coordinates for d1tj1a2.
(The format of our PDB-style files is described here.)

Timeline for d1tj1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tj1a1