Lineage for d1tfra2 (1tfr A:12-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921920Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 2921945Protein T4 RNase H [53046] (1 species)
  7. 2921946Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries)
  8. 2921949Domain d1tfra2: 1tfr A:12-180 [33351]
    Other proteins in same PDB: d1tfra1
    complexed with mg

Details for d1tfra2

PDB Entry: 1tfr (more details), 2.06 Å

PDB Description: rnase h from bacteriophage t4
PDB Compounds: (A:) t4 RNAse h

SCOPe Domain Sequences for d1tfra2:

Sequence, based on SEQRES records: (download)

>d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkyea
ddhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Sequence, based on observed residues (ATOM records): (download)

>d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykktwdwegyfesshkvidelkaympyivmdidkyeaddhiavlvk
kfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

SCOPe Domain Coordinates for d1tfra2:

Click to download the PDB-style file with coordinates for d1tfra2.
(The format of our PDB-style files is described here.)

Timeline for d1tfra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfra1