Lineage for d1sxda_ (1sxd A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737578Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1737579Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 1737609Protein GABP-alpha subunit [109867] (1 species)
  7. 1737610Species Mouse (Mus musculus) [TaxId:10090] [109868] (1 PDB entry)
    Uniprot Q00422 168-254 # structure of the Ets domain (320-429) is also known (46868)
  8. 1737611Domain d1sxda_: 1sxd A: [106079]

Details for d1sxda_

PDB Entry: 1sxd (more details)

PDB Description: solution structure of the pointed (pnt) domain from mgabpa
PDB Compounds: (A:) GA repeat binding protein, alpha

SCOPe Domain Sequences for d1sxda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]}
gshmaalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelc
slnqedffqrvprgeilwshlellrkyvlas

SCOPe Domain Coordinates for d1sxda_:

Click to download the PDB-style file with coordinates for d1sxda_.
(The format of our PDB-style files is described here.)

Timeline for d1sxda_: