Lineage for d1sq2n_ (1sq2 N:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023679Protein Novel antigen receptor (against lysozyme) [110042] (1 species)
  7. 2023680Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries)
    Uniprot Q8AXI4 # fragment
  8. 2023681Domain d1sq2n_: 1sq2 N: [105881]
    Other proteins in same PDB: d1sq2l_
    complexed with cl, edo

Details for d1sq2n_

PDB Entry: 1sq2 (more details), 1.45 Å

PDB Description: Crystal Structure Analysis of the Nurse Shark New Antigen Receptor (NAR) Variable Domain in Complex With Lysozyme
PDB Compounds: (N:) novel antigen receptor

SCOPe Domain Sequences for d1sq2n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtprsvtketgesltincvlrdasyalgstcwyrkksgegneesiskggryvetvns
gsksfslrindltvedggtyrcglgvaggycdyalcssryaecgdgtavtvn

SCOPe Domain Coordinates for d1sq2n_:

Click to download the PDB-style file with coordinates for d1sq2n_.
(The format of our PDB-style files is described here.)

Timeline for d1sq2n_: