Lineage for d1sn4a_ (1sn4 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257552Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2257553Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2257569Protein Scorpion toxin [57097] (17 species)
  7. 2257607Species Chinese scorpion (Buthus martensii), toxin m4 [TaxId:34649] [57108] (1 PDB entry)
  8. 2257608Domain d1sn4a_: 1sn4 A: [44136]
    complexed with act

Details for d1sn4a_

PDB Entry: 1sn4 (more details), 1.3 Å

PDB Description: structure of scorpion neurotoxin bmk m4
PDB Compounds: (A:) protein (neurotoxin bmk m4)

SCOPe Domain Sequences for d1sn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn4a_ g.3.7.1 (A:) Scorpion toxin {Chinese scorpion (Buthus martensii), toxin m4 [TaxId: 34649]}
vrdayiakpencvyhcagnegcnklctdngaesgycqwggrygnacwciklpddvpirvp
gkch

SCOPe Domain Coordinates for d1sn4a_:

Click to download the PDB-style file with coordinates for d1sn4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sn4a_: