Lineage for d1sfna_ (1sfn A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807389Family b.82.1.11: YlbA-like [101979] (4 proteins)
    Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains
  6. 1807394Protein Hypothetical protein DR1152 [110316] (1 species)
  7. 1807395Species Deinococcus radiodurans [TaxId:1299] [110317] (1 PDB entry)
    Uniprot Q9RV77
  8. 1807396Domain d1sfna_: 1sfn A: [105496]
    Structural genomics target

Details for d1sfna_

PDB Entry: 1sfn (more details), 2.46 Å

PDB Description: crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1sfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}
mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
nrhpl

SCOPe Domain Coordinates for d1sfna_:

Click to download the PDB-style file with coordinates for d1sfna_.
(The format of our PDB-style files is described here.)

Timeline for d1sfna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfnb_