Lineage for d1s9aa_ (1s9a A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) 
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
sandwich; 9 strands in 2 sheets
Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
similar overall structure to Catechol 1,2-dioxygenaseSpecies Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries)
Uniprot O67987
Domain d1s9aa_: 1s9a A: [105379]
complexed with bez, fe, hgp, tam
Details for d1s9aa_
PDB Entry: 1s9a (more details), 2.47 Å
PDB Description: crystal structure of 4-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp
PDB Compounds: (A:) Chlorocatechol 1,2-dioxygenaseSCOPe Domain Sequences for d1s9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn
SCOPe Domain Coordinates for d1s9aa_:
Click to download the PDB-style file with coordinates for d1s9aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s9aa_:
- d1s9aa_ first appeared in SCOP 1.69
- d1s9aa_ appears in SCOPe 2.06
- d1s9aa_ appears in the current release, SCOPe 2.08
View in 3D
