Lineage for d1s3ea1 (1s3e A:3-289,A:402-501)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1832683Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1832797Protein Monoamine oxidase B [69423] (2 species)
  7. 1832798Species Human (Homo sapiens) [TaxId:9606] [69424] (37 PDB entries)
  8. 1832803Domain d1s3ea1: 1s3e A:3-289,A:402-501 [98426]
    Other proteins in same PDB: d1s3ea2, d1s3eb2
    complexed with fad

Details for d1s3ea1

PDB Entry: 1s3e (more details), 1.6 Å

PDB Description: Crystal structure of MAOB in complex with 6-hydroxy-N-propargyl-1(R)-aminoindan
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1s3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s3ea1 c.3.1.2 (A:3-289,A:402-501) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrligltti

SCOPe Domain Coordinates for d1s3ea1:

Click to download the PDB-style file with coordinates for d1s3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1s3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s3ea2