Lineage for d1rroa_ (1rro A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489791Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 1489792Protein Oncomodulin [47493] (1 species)
  7. 1489793Species Norway rat (Rattus norvegicus) [TaxId:10116] [47494] (3 PDB entries)
  8. 1489794Domain d1rroa_: 1rro A: [17195]
    complexed with ca

Details for d1rroa_

PDB Entry: 1rro (more details), 1.3 Å

PDB Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution
PDB Compounds: (A:) rat oncomodulin

SCOPe Domain Sequences for d1rroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs

SCOPe Domain Coordinates for d1rroa_:

Click to download the PDB-style file with coordinates for d1rroa_.
(The format of our PDB-style files is described here.)

Timeline for d1rroa_: