Lineage for d1rro__ (1rro -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.4: Parvalbumin [47492] (2 proteins) 
Protein Oncomodulin [47493] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [47494] (2 PDB entries) 
Domain d1rro__: 1rro - [17195]
Details for d1rro__
PDB Entry: 1rro (more details), 1.3 Å
PDB Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution
SCOP Domain Sequences for d1rro__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rro__ a.39.1.4 (-) Oncomodulin {Rat (Rattus norvegicus)}
sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs
SCOP Domain Coordinates for d1rro__:
Click to download the PDB-style file with coordinates for d1rro__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rro__:
- d1rro__ appears in SCOP 1.57
- d1rro__ appears in the current release, SCOPe 2.08, called d1rroa_
View in 3D