Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.10: Replication initiation protein [46816] (3 proteins) duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry |
Protein RepE54 [46817] (1 species) |
Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries) |
Domain d1repc2: 1rep C:144-246 [16126] protein/DNA complex; complexed with mg |
PDB Entry: 1rep (more details), 2.6 Å
SCOPe Domain Sequences for d1repc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1repc2 a.4.5.10 (C:144-246) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]} nrftqfrlsetkeitnpyamrlyeslcqyrkpdgsgivslkidwiieryqlpqsyqrmpd frrrflqvcvneinsrtpmrlsyiekkkgrqtthivfsfrdit
Timeline for d1repc2: