Lineage for d1repc2 (1rep C:144-246)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetryProtein RepE54 [46817] (1 species) Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries) 
Domain d1repc2: 1rep C:144-246 [16126]
protein/DNA complex; complexed with mg
Details for d1repc2
PDB Entry: 1rep (more details), 2.6 Å
PDB Description: crystal structure of replication initiator protein repe54 of mini-f plasmid complexed with an iteron dna
PDB Compounds: (C:) protein (replication initiation protein)SCOPe Domain Sequences for d1repc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1repc2 a.4.5.10 (C:144-246) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
nrftqfrlsetkeitnpyamrlyeslcqyrkpdgsgivslkidwiieryqlpqsyqrmpd
frrrflqvcvneinsrtpmrlsyiekkkgrqtthivfsfrdit
SCOPe Domain Coordinates for d1repc2:
Click to download the PDB-style file with coordinates for d1repc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1repc2:
- d1repc2 first appeared (with stable ids) in SCOP 1.55
- d1repc2 appears in SCOPe 2.07
View in 3D
