Lineage for d1r72f4 (1r72 F:78-207)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins)
automatically mapped to Pfam PF02629Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
forms swapped dimer with C-terminal helicesSpecies Thermus aquaticus [TaxId:271] [102176] (3 PDB entries)
Uniprot Q9X2V5
CASP5
Domain d1r72f4: 1r72 F:78-207 [302981]
Other proteins in same PDB: d1r72a3, d1r72b3, d1r72c3, d1r72d3, d1r72e3, d1r72f3, d1r72g3
automated match to d1xcba2
complexed with ca, mg, nad
Details for d1r72f4
PDB Entry: 1r72 (more details), 2.9 Å
PDB Description: Crystal Structure of p25 from Thermus aquaticus
PDB Compounds: (F:) AT-rich DNA-binding protein p25SCOPe Domain Sequences for d1r72f4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r72f4 c.2.1.12 (F:78-207) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnpkwre
SCOPe Domain Coordinates for d1r72f4:
Click to download the PDB-style file with coordinates for d1r72f4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r72f4:
- d1r72f4 first appeared in SCOPe 2.06
- d1r72f4 appears in SCOPe 2.07
View in 3D
