Lineage for d1qkrb_ (1qkr B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263535Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1263536Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1263552Protein Vinculin [47224] (2 species)
  7. 1263553Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
    Uniprot P12003
  8. 1263555Domain d1qkrb_: 1qkr B: [16629]
    tail domain
    complexed with so4

Details for d1qkrb_

PDB Entry: 1qkr (more details), 1.8 Å

PDB Description: crystal structure of the vinculin tail and a pathway for activation
PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d1qkrb_:

Sequence, based on SEQRES records: (download)

>d1qkrb_ a.24.9.1 (B:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
ekdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrg
gsgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkils
tvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwv
rktpw

Sequence, based on observed residues (ATOM records): (download)

>d1qkrb_ a.24.9.1 (B:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
ekdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrg
gsgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkils
tvkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasiagftlrwvrktpw

SCOPe Domain Coordinates for d1qkrb_:

Click to download the PDB-style file with coordinates for d1qkrb_.
(The format of our PDB-style files is described here.)

Timeline for d1qkrb_: