![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.7: RraA-like [89562] (2 families) ![]() structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase |
![]() | Family c.8.7.1: RraA-like [89563] (5 proteins) aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli |
![]() | Protein Regulator of RNase E activity RraA (MenG) [102192] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102193] (1 PDB entry) |
![]() | Domain d1q5xa_: 1q5x A: [95947] |
PDB Entry: 1q5x (more details), 2 Å
SCOPe Domain Sequences for d1q5xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q5xa_ c.8.7.1 (A:) Regulator of RNase E activity RraA (MenG) {Escherichia coli [TaxId: 562]} kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag egigesdvrvnfggvtffsgdhlyadntgiilsedpldie
Timeline for d1q5xa_: