Lineage for d1q0xl2 (1q0x L:108-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360928Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2360929Domain d1q0xl2: 1q0x L:108-212 [95520]
    Other proteins in same PDB: d1q0xh1, d1q0xh2, d1q0xl1
    part of anti-morphine Fab 9b1
    complexed with pg4, so4

Details for d1q0xl2

PDB Entry: 1q0x (more details), 1.6 Å

PDB Description: Anti-morphine Antibody 9B1 Unliganded Form
PDB Compounds: (L:) Fab 9B1, light chain

SCOPe Domain Sequences for d1q0xl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkssptvtlfppsseelstakatlvctitdfypgvvtvdwkvdgtpvtagmettqpskq
snnkymassyltltarawerhssyscqvtheghssnktlsra

SCOPe Domain Coordinates for d1q0xl2:

Click to download the PDB-style file with coordinates for d1q0xl2.
(The format of our PDB-style files is described here.)

Timeline for d1q0xl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q0xl1