Lineage for d1q0xl1 (1q0x L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354589Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2354681Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2354683Domain d1q0xl1: 1q0x L:1-107 [95519]
    Other proteins in same PDB: d1q0xh1, d1q0xh2, d1q0xl2
    part of anti-morphine Fab 9b1
    complexed with pg4, so4

Details for d1q0xl1

PDB Entry: 1q0x (more details), 1.6 Å

PDB Description: Anti-morphine Antibody 9B1 Unliganded Form
PDB Compounds: (L:) Fab 9B1, light chain

SCOPe Domain Sequences for d1q0xl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0xl1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
davvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwsnnklvfgggtkltvlg

SCOPe Domain Coordinates for d1q0xl1:

Click to download the PDB-style file with coordinates for d1q0xl1.
(The format of our PDB-style files is described here.)

Timeline for d1q0xl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q0xl2