Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein Acetyl-coenzyme A carboxylase, C-terminal domain [418957] (1 species) protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419417] (8 PDB entries) Uniprot Q00955 |
Domain d1od2a2: 1od2 A:1815-2203 [86822] Other proteins in same PDB: d1od2a1, d1od2b1 complexed with aco, ade has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1od2 (more details), 2.7 Å
SCOPe Domain Sequences for d1od2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1od2a2 c.14.1.4 (A:1815-2203) Acetyl-coenzyme A carboxylase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw ieenyktlddklkglklesfaqdlakkir
Timeline for d1od2a2: