Lineage for d1o68b_ (1o68 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824470Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1824734Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 1824735Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 1824753Species Neisseria meningitidis [TaxId:487] [102100] (2 PDB entries)
  8. 1824760Domain d1o68b_: 1o68 B: [92556]
    structural genomics
    complexed with kiv, na

Details for d1o68b_

PDB Entry: 1o68 (more details), 2.1 Å

PDB Description: crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase
PDB Compounds: (B:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d1o68b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o68b_ c.1.12.8 (B:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]}
slitvntlqkmkaagekiamltayessfaalmddagvemllvgdslgmavqgrkstlpvs
lrdmcyhtecvargaknamivsdlpfgayqqskeqafaaaaelmaagahmvkleggvwma
etteflqmrgipvcahigltpqsvfafggykvqgrggkaqallndakahddagaavvlme
cvlaelakkvtetvscptigigagadcdgqvlvmhdmlgifpgktakfvknfmqghdsvq
aavrayvaevkaktfpaaehif

SCOPe Domain Coordinates for d1o68b_:

Click to download the PDB-style file with coordinates for d1o68b_.
(The format of our PDB-style files is described here.)

Timeline for d1o68b_: