Lineage for d1o1xa_ (1o1x A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885147Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 1885148Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 1885149Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 1885187Protein Putative sugar-phosphate isomerase [89627] (1 species)
  7. 1885188Species Thermotoga maritima [TaxId:2336] [89628] (1 PDB entry)
    TM1080
  8. 1885189Domain d1o1xa_: 1o1x A: [86553]
    structural genomics
    complexed with mpd

Details for d1o1xa_

PDB Entry: 1o1x (more details), 1.9 Å

PDB Description: crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (A:) ribose-5-phosphate isomerase RpiB

SCOPe Domain Sequences for d1o1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o1xa_ c.121.1.1 (A:) Putative sugar-phosphate isomerase {Thermotoga maritima [TaxId: 2336]}
hhvkiaiasdhaafelkekvknyllgkgievedhgtyseesvdypdyakkvvqsilsnea
dfgillcgtglgmsiaanryrgiraalclfpdmarlarshnnanilvlpgrligaelafw
ivdtflstpfdggrherrirkidev

SCOPe Domain Coordinates for d1o1xa_:

Click to download the PDB-style file with coordinates for d1o1xa_.
(The format of our PDB-style files is described here.)

Timeline for d1o1xa_: