Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins) automatically mapped to Pfam PF02502 |
Protein Putative sugar-phosphate isomerase [89627] (1 species) |
Species Thermotoga maritima [TaxId:2336] [89628] (1 PDB entry) TM1080 |
Domain d1o1xa_: 1o1x A: [86553] structural genomics complexed with mpd |
PDB Entry: 1o1x (more details), 1.9 Å
SCOPe Domain Sequences for d1o1xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o1xa_ c.121.1.1 (A:) Putative sugar-phosphate isomerase {Thermotoga maritima [TaxId: 2336]} hhvkiaiasdhaafelkekvknyllgkgievedhgtyseesvdypdyakkvvqsilsnea dfgillcgtglgmsiaanryrgiraalclfpdmarlarshnnanilvlpgrligaelafw ivdtflstpfdggrherrirkidev
Timeline for d1o1xa_: