![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
![]() | Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (2 species) |
![]() | Species Influenza A virus [TaxId:11320] [47063] (2 PDB entries) |
![]() | Domain d1ns1a_: 1ns1 A: [16382] |
PDB Entry: 1ns1 (more details)
SCOPe Domain Sequences for d1ns1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ns1a_ a.16.1.1 (A:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus [TaxId: 11320]} mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv gkqivekilkees
Timeline for d1ns1a_: