Lineage for d1n7ea_ (1n7e A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1785938Protein Glutamate receptor-interacting protein 1, GRIP1 [101717] (1 species)
  7. 1785939Species Norway rat (Rattus norvegicus) [TaxId:10116] [101718] (2 PDB entries)
  8. 1785940Domain d1n7ea_: 1n7e A: [91691]
    sixth PDZ domain

Details for d1n7ea_

PDB Entry: 1n7e (more details), 1.5 Å

PDB Description: Crystal structure of the sixth PDZ domain of GRIP1
PDB Compounds: (A:) AMPA receptor interacting protein GRIP

SCOPe Domain Sequences for d1n7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gaiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilainsss
lkgkplseaihllqmagetvtlkikkqtdaqpass

SCOPe Domain Coordinates for d1n7ea_:

Click to download the PDB-style file with coordinates for d1n7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1n7ea_: