Lineage for d1n68a1 (1n68 A:30-170)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114921Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 1115021Protein multi-copper oxidase CueO [69194] (1 species)
  7. 1115022Species Escherichia coli [TaxId:562] [69195] (7 PDB entries)
  8. 1115029Domain d1n68a1: 1n68 A:30-170 [85356]
    complexed with c2c, cu

Details for d1n68a1

PDB Entry: 1n68 (more details), 1.7 Å

PDB Description: Copper bound to the Multicopper Oxidase CueO
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d1n68a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n68a1 b.6.1.3 (A:30-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
rqvamglaglvvieddeilkl

SCOPe Domain Coordinates for d1n68a1:

Click to download the PDB-style file with coordinates for d1n68a1.
(The format of our PDB-style files is described here.)

Timeline for d1n68a1: