Lineage for d1m15a2 (1m15 A:96-357)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
duplication: common core consists of two beta-alpha-beta2-alpha repeatsSuperfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) 
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
automatically mapped to Pfam PF00217Protein Arginine kinase, C-terminal domain [55942] (2 species) Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries)
Uniprot P51541
Domain d1m15a2: 1m15 A:96-357 [78369]
Other proteins in same PDB: d1m15a1
complexed with adp, arg, mg, no3
Details for d1m15a2
PDB Entry: 1m15 (more details), 1.2 Å
PDB Description: transition state structure of arginine kinase
PDB Compounds: (A:) arginine kinaseSCOPe Domain Sequences for d1m15a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m15a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa
SCOPe Domain Coordinates for d1m15a2:
Click to download the PDB-style file with coordinates for d1m15a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1m15a2:
- d1m15a2 first appeared in SCOP 1.63
- d1m15a2 appears in SCOPe 2.05
- d1m15a2 appears in SCOPe 2.07
- d1m15a2 appears in the current release, SCOPe 2.08
View in 3D
