Lineage for d1lwra_ (1lwr A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767896Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
  7. 1767918Species Norway rat (Rattus norvegicus) [TaxId:10116] [89198] (1 PDB entry)
  8. 1767919Domain d1lwra_: 1lwr A: [84731]
    second Fn3 module

Details for d1lwra_

PDB Entry: 1lwr (more details)

PDB Description: solution structure of the ncam fibronectin type iii module 2
PDB Compounds: (A:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOPe Domain Sequences for d1lwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwra_ b.1.2.1 (A:) Neural cell adhesion molecule 1, NCAM {Norway rat (Rattus norvegicus) [TaxId: 10116]}
agpsapklegqmgedgnsikvnlikqddggspirhylvkyralasewkpeirlpsgsdhv
mlksldwnaeyevyvvaenqqgkskaahfvfrtsaq

SCOPe Domain Coordinates for d1lwra_:

Click to download the PDB-style file with coordinates for d1lwra_.
(The format of our PDB-style files is described here.)

Timeline for d1lwra_: