Lineage for d1kx5b_ (1kx5 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725987Protein Histone H4 [47125] (7 species)
  7. 1725988Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries)
  8. 1725990Domain d1kx5b_: 1kx5 B: [77594]
    Other proteins in same PDB: d1kx5a_, d1kx5c_, d1kx5d_, d1kx5e_, d1kx5g_, d1kx5h_
    protein/DNA complex; complexed with cl, mn

Details for d1kx5b_

PDB Entry: 1kx5 (more details), 1.94 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d1kx5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx5b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1kx5b_:

Click to download the PDB-style file with coordinates for d1kx5b_.
(The format of our PDB-style files is described here.)

Timeline for d1kx5b_: