![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries) |
![]() | Domain d1kx5b_: 1kx5 B: [77594] Other proteins in same PDB: d1kx5a_, d1kx5c_, d1kx5d_, d1kx5e_, d1kx5g_, d1kx5h_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 1kx5 (more details), 1.94 Å
SCOPe Domain Sequences for d1kx5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kx5b_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
Timeline for d1kx5b_: