Lineage for d1kklc_ (1kkl C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008019Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 1008020Superfamily c.91.1: PEP carboxykinase-like [53795] (2 families) (S)
  5. 1008056Family c.91.1.2: HPr kinase HprK C-terminal domain [64186] (1 protein)
  6. 1008057Protein HPr kinase HprK C-terminal domain [64187] (3 species)
  7. 1008058Species Lactobacillus casei [TaxId:1582] [64188] (4 PDB entries)
  8. 1008064Domain d1kklc_: 1kkl C: [72650]
    Other proteins in same PDB: d1kklh_, d1kkli_, d1kklj_
    C-terminal domain in complex with HPr
    complexed with ca

Details for d1kklc_

PDB Entry: 1kkl (more details), 2.8 Å

PDB Description: l.casei hprk/p in complex with b.subtilis hpr
PDB Compounds: (C:) hprk protein

SCOPe Domain Sequences for d1kklc_:

Sequence, based on SEQRES records: (download)

>d1kklc_ c.91.1.2 (C:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
aerrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivg
aappilshlleirglgiidvmnlfgagavredttislivhlenwtpdktfdrlgsgeqtq
lifdvpvpkitvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee

Sequence, based on observed residues (ATOM records): (download)

>d1kklc_ c.91.1.2 (C:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}
aerrsmhgvlvdiyglgvlitgdsgvgksetalelvqrghrliaddrvdvyqqdeqtivg
aappilshlleirglgiidvmnlfgagavredttislivhlenwtpdeqtqlifdvpvpk
itvpvkvgrnlaiiievaamnfraksmgydatktfeknlnhliehnee

SCOPe Domain Coordinates for d1kklc_:

Click to download the PDB-style file with coordinates for d1kklc_.
(The format of our PDB-style files is described here.)

Timeline for d1kklc_: