Class a: All alpha proteins [46456] (289 folds) |
Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) |
Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
Protein C5a anaphylotoxin [47688] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries) |
Domain d1kjsa_: 1kjs A: [17792] |
PDB Entry: 1kjs (more details)
SCOPe Domain Sequences for d1kjsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjsa_ a.50.1.1 (A:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]} mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq lranishkdmqlgr
Timeline for d1kjsa_: