Class b: All beta proteins [48724] (174 folds) |
Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) |
Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (3 proteins) |
Protein Lectin (agglutinin) [51112] (4 species) |
Species Snowdrop (Galanthus nivalis) [TaxId:4670] [51113] (3 PDB entries) |
Domain d1jpca_: 1jpc A: [27986] |
PDB Entry: 1jpc (more details), 2 Å
SCOPe Domain Sequences for d1jpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} dnilysgetlstgeflnygsfvfimqedcnlvlydvdkpiwatntgglsrscflsmqtdg nlvvynpsnkpiwasntggqngnyvcilqkdrnvviygtdrwatgtht
Timeline for d1jpca_: