Lineage for d1jmsa4 (1jms A:303-510)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563810Protein Terminal deoxynucleotidyl transferase [81581] (1 species)
  7. 2563811Species Mouse (Mus musculus) [TaxId:10090] [81580] (3 PDB entries)
  8. 2563812Domain d1jmsa4: 1jms A:303-510 [75863]
    Other proteins in same PDB: d1jmsa1, d1jmsa3
    complexed with mg, na

Details for d1jmsa4

PDB Entry: 1jms (more details), 2.36 Å

PDB Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase
PDB Compounds: (A:) terminal deoxynucleotidyltransferase

SCOPe Domain Sequences for d1jmsa4:

Sequence, based on SEQRES records: (download)

>d1jmsa4 d.218.1.2 (A:303-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhseksgq
qegkgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtk
rvfleaeseeeifahlgldyiepwerna

Sequence, based on observed residues (ATOM records): (download)

>d1jmsa4 d.218.1.2 (A:303-510) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
vnrpeaeavsmlvkeavvtflpdalvtmtggfrrgkmtghdvdflitspeatedeeqqll
hkvtdfwkqqglllycdilestfekfkqpsrkvdaldhfqkcflilkldhgrvhsekseg
kgwkairvdlvmcpydrrafallgwtgsrqferdlrryatherkmmldnhalydrtkrvf
leaeseeeifahlgldyiepwerna

SCOPe Domain Coordinates for d1jmsa4:

Click to download the PDB-style file with coordinates for d1jmsa4.
(The format of our PDB-style files is described here.)

Timeline for d1jmsa4: