Lineage for d1jcha3 (1jch A:316-454)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1970480Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 1970568Superfamily h.4.9: Colicin E3 receptor domain [69985] (1 family) (S)
  5. 1970569Family h.4.9.1: Colicin E3 receptor domain [69986] (1 protein)
  6. 1970570Protein Colicin E3 receptor domain [69987] (1 species)
  7. 1970571Species Escherichia coli [TaxId:562] [69988] (4 PDB entries)
  8. 1970576Domain d1jcha3: 1jch A:316-454 [66493]
    Other proteins in same PDB: d1jcha1, d1jcha2, d1jchb_, d1jchc1, d1jchc2, d1jchd_
    protein/RNA complex; complexed with cit, gol

Details for d1jcha3

PDB Entry: 1jch (more details), 3.02 Å

PDB Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein
PDB Compounds: (A:) Colicin E3

SCOPe Domain Sequences for d1jcha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcha3 h.4.9.1 (A:316-454) Colicin E3 receptor domain {Escherichia coli [TaxId: 562]}
veaaernyeraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqf
nrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkk
edkkrsaennlndeknkpr

SCOPe Domain Coordinates for d1jcha3:

Click to download the PDB-style file with coordinates for d1jcha3.
(The format of our PDB-style files is described here.)

Timeline for d1jcha3: