![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
![]() | Superfamily g.12.1: LDL receptor-like module [57424] (2 families) ![]() |
![]() | Family g.12.1.1: LDL receptor-like module [57425] (7 proteins) |
![]() | Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries) Uniprot P01130 272-353 |
![]() | Domain d1j8ea_: 1j8e A: [66437] seventh module complexed with ca |
PDB Entry: 1j8e (more details), 1.85 Å
SCOPe Domain Sequences for d1j8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} gshscsstqfkcnsgrcipehwtcdgdndcgdysdethanctnq
Timeline for d1j8ea_: