PDB entry 1j8e

View 1j8e on RCSB PDB site
Description: Crystal structure of ligand-binding repeat CR7 from LRP
Class: signaling protein
Keywords: ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein
Deposited on 2001-05-21, released 2001-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low-density lipoprotein receptor-related protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07954 (0-43)
      • engineered (0)
    Domains in SCOPe 2.07: d1j8ea_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j8eA (A:)
    gshscsstqfkcnsgrcipehwtcdgdndcgdysdethanctnq