Lineage for d1h4fa2 (1h4f A:254-406)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1186522Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 1186543Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 1186544Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
    Uniprot P14926
  8. 1186618Domain d1h4fa2: 1h4f A:254-406 [90610]
    complexed with nh4

Details for d1h4fa2

PDB Entry: 1h4f (more details), 2 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i k328r
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d1h4fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4fa2 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatramtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d1h4fa2:

Click to download the PDB-style file with coordinates for d1h4fa2.
(The format of our PDB-style files is described here.)

Timeline for d1h4fa2: