Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries) |
Domain d1gsma1: 1gsm A:1-90 [65535] |
PDB Entry: 1gsm (more details), 1.9 Å
SCOPe Domain Sequences for d1gsma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr naslsaagtrvcvgscggrtfqhtvqllvy
Timeline for d1gsma1: