Lineage for d1gsma1 (1gsm A:1-90)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518946Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)
  7. 1518947Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries)
  8. 1518948Domain d1gsma1: 1gsm A:1-90 [65535]

Details for d1gsma1

PDB Entry: 1gsm (more details), 1.9 Å

PDB Description: a reassessment of the madcam-1 structure and its role in integrin recognition.
PDB Compounds: (A:) mucosal addressin cell adhesion molecule-1

SCOPe Domain Sequences for d1gsma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
naslsaagtrvcvgscggrtfqhtvqllvy

SCOPe Domain Coordinates for d1gsma1:

Click to download the PDB-style file with coordinates for d1gsma1.
(The format of our PDB-style files is described here.)

Timeline for d1gsma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsma2