Lineage for d1grja1 (1grj A:2-79)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.1: GreA transcript cleavage protein, N-terminal domain [46557] (2 families) 
automatically mapped to Pfam PF03449Family a.2.1.1: GreA transcript cleavage protein, N-terminal domain [46558] (1 protein) Protein GreA transcript cleavage protein, N-terminal domain [46559] (3 species)
C-terminal domain is FKBP-like
Species Escherichia coli [TaxId:562] [46560] (1 PDB entry) 
Domain d1grja1: 1grj A:2-79 [15691]
Other proteins in same PDB: d1grja2
Details for d1grja1
PDB Entry: 1grj (more details), 2.2 Å
PDB Description: grea transcript cleavage factor from escherichia coli
PDB Compounds: (A:) grea proteinSCOPe Domain Sequences for d1grja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grja1 a.2.1.1 (A:2-79) GreA transcript cleavage protein, N-terminal domain {Escherichia coli [TaxId: 562]}
qaipmtlrgaeklreeldflksvrrpeiiaaiaearehgdlkenaeyhaareqqgfcegr
ikdieaklsnaqvidvtk
SCOPe Domain Coordinates for d1grja1:
Click to download the PDB-style file with coordinates for d1grja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1grja1:
- d1grja1 first appeared (with stable ids) in SCOP 1.55, called d1grj_1
- d1grja1 appears in SCOPe 2.05
- d1grja1 appears in SCOPe 2.07
- d1grja1 appears in the current release, SCOPe 2.08
View in 3D
