Lineage for d1gifa_ (1gif A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032730Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1032731Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1032854Family d.80.1.3: MIF-related [55339] (3 proteins)
  6. 1032863Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 1032869Species Human (Homo sapiens) [TaxId:9606] [55341] (27 PDB entries)
  8. 1032924Domain d1gifa_: 1gif A: [39837]

Details for d1gifa_

PDB Entry: 1gif (more details), 1.9 Å

PDB Description: human glycosylation-inhibiting factor
PDB Compounds: (A:) glycosylation-inhibiting factor

SCOPe Domain Sequences for d1gifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gifa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
mpmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalc
slhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d1gifa_:

Click to download the PDB-style file with coordinates for d1gifa_.
(The format of our PDB-style files is described here.)

Timeline for d1gifa_: