Lineage for d1ghqc2 (1ghq C:67-134)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064241Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1064242Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1064243Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1064435Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 1064436Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)
  8. 1064442Domain d1ghqc2: 1ghq C:67-134 [60525]
    Other proteins in same PDB: d1ghqa_
    complexed with C3D
    complexed with ndg, zn

Details for d1ghqc2

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure
PDB Compounds: (C:) cr2/cd121/c3d/epstein-barr virus receptor

SCOPe Domain Sequences for d1ghqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqc2 g.18.1.1 (C:67-134) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
nkysscpepivpggykirgstpyrhgdsvtfacktnfsmngnksvwcqannmwgptrlpt
cvsvfple

SCOPe Domain Coordinates for d1ghqc2:

Click to download the PDB-style file with coordinates for d1ghqc2.
(The format of our PDB-style files is described here.)

Timeline for d1ghqc2:

1064442
d1ghqc2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ghqc1