Lineage for d1g5ca_ (1g5c A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136876Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2136941Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2136942Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2136943Protein beta-carbonic anhydrase [53058] (4 species)
  7. 2136953Species Methanobacterium thermoautotrophicum [TaxId:145262] [64084] (1 PDB entry)
  8. 2136954Domain d1g5ca_: 1g5c A: [60264]
    complexed with ca, epe, zn

Details for d1g5ca_

PDB Entry: 1g5c (more details), 2.1 Å

PDB Description: crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum
PDB Compounds: (A:) beta-carbonic anhydrase

SCOPe Domain Sequences for d1g5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ca_ c.53.2.1 (A:) beta-carbonic anhydrase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iikdilrenqdfrfrdlsdlkhspklciitcmdsrlidlleralgigrgdakviknagni
vddgvirsaavaiyalgdneiiivghtdcgmarldedlivsrmrelgveeevienfsidv
lnpvgdeeenviegvkrlkssplipesigvhgliidintgrlkplylde

SCOPe Domain Coordinates for d1g5ca_:

Click to download the PDB-style file with coordinates for d1g5ca_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ca_: