Lineage for d1fpsa_ (1fps A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731438Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2731439Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 2731440Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)
  8. 2731442Domain d1fpsa_: 1fps A: [19436]

Details for d1fpsa_

PDB Entry: 1fps (more details), 2.6 Å

PDB Description: crystal structure of recombinant farnesyl diphosphate synthase at 2.6 angstroms resolution
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d1fpsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqafflvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

SCOPe Domain Coordinates for d1fpsa_:

Click to download the PDB-style file with coordinates for d1fpsa_.
(The format of our PDB-style files is described here.)

Timeline for d1fpsa_: