Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries) |
Domain d1fpsa_: 1fps A: [19436] |
PDB Entry: 1fps (more details), 2.6 Å
SCOPe Domain Sequences for d1fpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fpsa_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]} spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv aayrelsgpgqkdaeslrcalavgwcielfqafflvaddimdqsltrrgqlcwykkegvg ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk
Timeline for d1fpsa_: