Lineage for d1edoa_ (1edo A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2103151Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2103172Species Oil seed rape (Brassica napus) [TaxId:3708] [51789] (2 PDB entries)
  8. 2103173Domain d1edoa_: 1edo A: [29896]
    complexed with nap

Details for d1edoa_

PDB Entry: 1edo (more details), 2.3 Å

PDB Description: the x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with nadp+
PDB Compounds: (A:) beta-keto acyl carrier protein reductase

SCOPe Domain Sequences for d1edoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}
spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
giai

SCOPe Domain Coordinates for d1edoa_:

Click to download the PDB-style file with coordinates for d1edoa_.
(The format of our PDB-style files is described here.)

Timeline for d1edoa_: