Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [48401] (6 PDB entries) |
Domain d1e8xa1: 1e8x A:525-725 [19148] Other proteins in same PDB: d1e8xa2, d1e8xa3, d1e8xa4, d1e8xa5 complexed with atp, lu |
PDB Entry: 1e8x (more details), 2.2 Å
SCOPe Domain Sequences for d1e8xa1:
Sequence, based on SEQRES records: (download)
>d1e8xa1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]} hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d1e8xa1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]} hpialempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssvkwgq qeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyl lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay lrgcg
Timeline for d1e8xa1:
View in 3D Domains from same chain: (mouse over for more information) d1e8xa2, d1e8xa3, d1e8xa4, d1e8xa5 |