![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Pseudoazurin [49522] (4 species) |
![]() | Species Achromobacter cycloclastes [TaxId:223] [49525] (4 PDB entries) |
![]() | Domain d1bqka_: 1bqk A: [22889] complexed with cu |
PDB Entry: 1bqk (more details), 1.35 Å
SCOPe Domain Sequences for d1bqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala algn
Timeline for d1bqka_: