Lineage for d1bora_ (1bor A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642222Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2642223Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2642224Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2642225Protein Acute promyelocytic leukaemia proto-oncoprotein PML [57858] (1 species)
  7. 2642226Species Human (Homo sapiens) [TaxId:9606] [57859] (2 PDB entries)
  8. 2642228Domain d1bora_: 1bor A: [45324]
    complexed with zn

Details for d1bora_

PDB Entry: 1bor (more details)

PDB Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
PDB Compounds: (A:) transcription factor pml

SCOPe Domain Sequences for d1bora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal

SCOPe Domain Coordinates for d1bora_:

Click to download the PDB-style file with coordinates for d1bora_.
(The format of our PDB-style files is described here.)

Timeline for d1bora_: