SCOP 1.55: Domain d1bor__: 1bor -

Lineage for d1bor__ (1bor -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)

4. Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family)

5. Family g.44.1.1: RING finger domain, C3HC4 [57851] (5 proteins)

6. Protein Acute promyelocytic leukaemia proto-onkoprotein PML [57858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57859] (1 PDB entry)

8. Domain d1bor__: 1bor - [45324]

Details for d1bor__

PDB Entry: 1bor

PDB Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc

SCOP Domain Sequences for d1bor__:

Sequence; same for both SEQRES and ATOM records:

>d1bor__ g.44.1.1 (-) Acute promyelocytic leukaemia proto-onkoprotein PML {Human (Homo sapiens)}
eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal

Timeline for d1bor__:

• d1bor__ appears in SCOP 1.57
  
• d1bor__ appears in the current release, SCOPe 2.08, called d1bora_