Lineage for d1bf6a_ (1bf6 A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
automatically mapped to Pfam PF02126
Protein Phosphotriesterase homology protein [51567] (1 species) Species Escherichia coli [TaxId:562] [51568] (1 PDB entry) 
Domain d1bf6a_: 1bf6 A: [29065]
complexed with gol, mpd, so4, zn
Details for d1bf6a_
PDB Entry: 1bf6 (more details), 1.7 Å
PDB Description: phosphotriesterase homology protein from escherichia coli
PDB Compounds: (A:) phosphotriesterase homology proteinSCOPe Domain Sequences for d1bf6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]}
sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr
naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag
iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr
vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls
mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq
SCOPe Domain Coordinates for d1bf6a_:
Click to download the PDB-style file with coordinates for d1bf6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bf6a_:
View in 3D
