Lineage for d1bf6a_ (1bf6 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (3 families) 
Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins) Protein Phosphotriesterase homology protein [51567] (1 species) Species Escherichia coli [TaxId:562] [51568] (1 PDB entry) 
Domain d1bf6a_: 1bf6 A: [29065]
Details for d1bf6a_
PDB Entry: 1bf6 (more details), 1.7 Å
PDB Description: phosphotriesterase homology protein from escherichia coli
SCOP Domain Sequences for d1bf6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli}
sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr
naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag
iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr
vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls
mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq
SCOP Domain Coordinates for d1bf6a_:
Click to download the PDB-style file with coordinates for d1bf6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bf6a_:
- d1bf6a_ appears in SCOP 1.57
- d1bf6a_ appears in the current release, SCOPe 2.08
View in 3D
