Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (3 families) |
Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins) |
Protein Phosphotriesterase homology protein [51567] (1 species) |
Species Escherichia coli [TaxId:562] [51568] (1 PDB entry) |
Domain d1bf6a_: 1bf6 A: [29065] |
PDB Entry: 1bf6 (more details), 1.7 Å
SCOP Domain Sequences for d1bf6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli} sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq
Timeline for d1bf6a_: