Lineage for d1b6ga_ (1b6g A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151248Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2151249Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2151269Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)
  8. 2151270Domain d1b6ga_: 1b6g A: [34661]
    complexed with cl, gol, so4

Details for d1b6ga_

PDB Entry: 1b6g (more details), 1.15 Å

PDB Description: haloalkane dehalogenase at ph 5.0 containing chloride
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d1b6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
mvnairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

SCOPe Domain Coordinates for d1b6ga_:

Click to download the PDB-style file with coordinates for d1b6ga_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ga_: