Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
Protein Cholesterol oxidase [54375] (3 species) |
Species Streptomyces sp. [TaxId:1931] [54377] (13 PDB entries) |
Domain d1b4va2: 1b4v A:319-450 [37865] Other proteins in same PDB: d1b4va1 complexed with fad |
PDB Entry: 1b4v (more details), 1.5 Å
SCOPe Domain Sequences for d1b4va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4va2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]} gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk afaddfcyhplg
Timeline for d1b4va2: