![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein EphB2 receptor [47776] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries) |
![]() | Domain d1b4fb_: 1b4f B: [17935] |
PDB Entry: 1b4f (more details), 1.95 Å
SCOPe Domain Sequences for d1b4fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4fb_ a.60.1.2 (B:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} trpdytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkki lnsiqvmraqmnqiqsv
Timeline for d1b4fb_: