Lineage for d1b08a2 (1b08 A:204-234)

  1. Root: SCOPe 2.01
  2. 1067937Class h: Coiled coil proteins [57942] (7 folds)
  3. 1067938Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1067939Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 1067940Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 1068012Protein Surfactant protein [57949] (2 species)
  7. 1068013Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (15 PDB entries)
  8. 1068053Domain d1b08a2: 1b08 A:204-234 [45423]
    Other proteins in same PDB: d1b08a1, d1b08b1, d1b08c1
    complexed with ca

Details for d1b08a2

PDB Entry: 1b08 (more details), 2.3 Å

PDB Description: lung surfactant protein d (sp-d) (fragment)
PDB Compounds: (A:) protein (lung surfactant protein d)

SCOPe Domain Sequences for d1b08a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b08a2 h.1.1.1 (A:204-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
vaslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d1b08a2:

Click to download the PDB-style file with coordinates for d1b08a2.
(The format of our PDB-style files is described here.)

Timeline for d1b08a2: